<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patLOP 00_LOP710 France 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 SQV| NVP| IDV| DDI| D4T| 3TC 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S L10I, I13V, K14R, I15V, K20I, E35D, M36I, N37Q, R41K, I62V, L63P, A71T  
>00_LOP710| codons 1-99
PQITLWQRPIVTVRVGGQLIEALLDTGADDTVLEDIQLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTISTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y K219N Y181C, G190A V108I V35I, T39A, S68G, K102Q, V118I, K122E, I135T, E203K, Q207E, H208Y, R211K  
>00_LOP710| codons 1-243
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAELEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVASDLEIGQHRTKIKELREYLWKWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQP

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005