<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patNAT 01_NAT716 France 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC+ AZT 21
2 AZT+ 3TC 26
3 IDV+ D4T+ 3TC 34
4 SQV+ RTV+ AZT+ 3TC 47
5 SQV+ RTV+ DDI 74
6 NVP+ NFV+ AZT+ 3TC 26
7 NVP+ ABC 21
8 NVP+ LPV+ ABC+ 3TC 21
9 RTV+ DDI+ APV+ 3TC 24

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54V, V82A, I84V Q58E L10I, K14R, K20R, M36I, L63T, I64V, K70T  
>01_NAT716| codons 1-99
PQITLWQRPIVTIRIGGQLREALLDTGADDTVLEEINLPGRWKPKLIVGIGGFVKVREYD
QITVEICGHTAIGTVLVGPTPANVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y K219R K103N, Y181C, G190A   V35I, K43Q, E44D, V118I, E169D, H208Y, R211K, K223Q, L228R  
>01_NAT716| codons 1-244
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEQDGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
CQYVDDLYVASDLEIGQHRTKIEELRQYLWKWGFYTPDRKHQQEPPFRWMGYELHPDKWT
VQPI

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005