<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patNIB 01_NIB719 France 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 59
2 3TC+AZT 61
3 None 19
4 3TC+DDI+NFV 61
5 3TC+DDI+NFV 17
6 3TC+AZT+DDI+NFV 16
7 None 22
8 ABC+AZT+DDI 7
9 3TC+AZT+EFV 9

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M L23I T12S, I13V, I15V, L19I, K20T, E35D, M36I, N37R, R41N, Q61E, L63A, I64M, H69K, V82I, L89M, I93L  
>01_NIB719| codons 1-99
PQITLWQRPLVSVKVGGQITEAILDTGADDTVLEDIRLPGNWKPKMIGGIGGFIKVRQYD
EIAMEICGKKAIGTVLVGPTPINIIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, L74V, M184V   L100I, K101E, K103N, V106M   K20R, V35T, E36A, T39E, S48T, K122E, D123N, K173A, D177E, T200A, Q207E, R211K  
>01_NIB719| codons 1-241
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKRKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIEKNKSMTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
V

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004