<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patGUZ 01_GUZ714 France 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ ABC+ AZT 157

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, Y115F, M184V D67E     K49R, V90I, D123E, T165I, I202V, E204D, F214L  
>01_GUZ714| codons 28-236
EEKIKALVEICTEMEKEGKISRIGPENPYNTPVFAIKKKESTRWRKLVDFRELNKRTQDF
WEIQLGIPHPAGLKKKKSVTVLDVGDAFFSVPLDKEFRKYTAFTIPSINNETPGIRYQYN
VLPQGWKGSPAIFQSSMIKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKVEDLRQ
HLLRWGLTTPDKKHQKEPPFLWMGYELHP

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005