<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patTUR 02_VIG701 France 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 SQV+ RTV+ D4T+ 3TC 160
2 SQV+ RTV+ DDC+ D4T+ 3TC 4
3 SQV+ RTV+ D4T+ 3TC 33

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, I84V L24I L10I, I15V, M36V, P39Q, I62V, L63P, A71V  
>02_VIG701| codons 1-99
PQITLWQRPIVTIKVGGQLKEALIDTGADDTVLEEVNLQGRWKPKLIGGIGGFVKVRQYD
QVPIEICGHKVIGTVLVGPTPANVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       K20R, V179I, I202V, R211K  
>02_VIG701| codons 1-238
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRTKVEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDK

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005