<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patMIC C 02_MICC721 France 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 26
2 AZT+ DDI 31
3 3TC+ AZT 18
4 AZT+ DDC+ RTV 10
5 AZT+ DDI+ RTV 21
6 3TC+ D4T+ IDV 24
7 3TC+ D4T+ SQV 46
8 3TC+ D4T+ NFV+ NVP 47
9 3TC+ D4T+ NVP+ RTV+ SQV 17
10 3TC+ APV+ D4T+ NVP 17
11 APV+ D4T+ DDI+ EFV 23
12 D4T+ DDI+ EFV+ RTV+ SQV 5
13 APV+ D4T+ DDI+ EFV 16
14 D4T+ EFV+ RTV+ SQV 31
15 D4T+ RTV+ SQV 3
16 D4T+ EFV+ RTV+ SQV 26
17 3TC+ EFV+ RTV 20

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, I84V, L90M Q58E L10I, D60E, I62V, L63P, A71V  
>02_MICC721| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVREYE
QVPIEICGHKVIGTVLVGPTPANVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219R K103N   E44D, V60I, V118I, K122E, I135T, N175H, K201M L26F
>02_MICC721| codons 1-239
PISPIETVPVKLKPGMDGPKVKQWPFTEEKIKALVEICTELEKDGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQHPDIVI
YQYVDDLYVGSDLEIGQHRTMIEELRQHLWRWGFYTPDRKHQKEPPFLWMGYELHPDKW

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005