<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patDOI 00_DOI704 France 1999 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 AZT 84
2 AZT+DDC 52
3 AZT+DDI 15
4 D4T+DDI 68
5 None 14
6 D4T+DDI+SQV 15
7 3TC+D4T+SQV 55
8 None 19
9 3TC+ABC+SQV 27
10 3TC+ABC+NFV 14
11 3TC+ABC+IDV+RTV 29
12 3TC+ABC+AZT+IDV 36

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16E, M36I, R41K, I72V  
>00_DOI704| codons 1-99
PQITLWQRPLVTIKIEGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, V75M, M184V, L210W, T215Y K219E     V35T, E40F, K43E, V60I, V118I, D121H, K122E, I135T, S162A, D177E, Q207E, H208Y, R211K, K223Q, L228H  
>00_DOI704| codons 1-240
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTFLEEEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELREYLWKWGFYTPDEKHQQEPPFHWMGYELHPDKWT

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004