<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patLEV J 01_LEV707 France 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 39
2 D4T+ 3TC 52
3 IDV+ DDC+ AZT 25
4 IDV+ AZT+ 3TC 43
5 NFV+ DDI+ D4T 12
6 SQV+ NFV+ DDI 78
7 NVP+ ABC+ 3TC 13
8 NVP+ DDI+ 3TC 50

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y K219N K101E, Y181C, G190A V108I K20R, K43E, V60I, V118I, K122E, I135V, R211K  
>01_LEV707| codons 1-240
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEEEGKISKIGPENPYNTPI
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVASDLEIGQHRTKIEELRQHLWKWGFYTPDNKHQKEPPFLWMGYELHPDKWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, M36I, R41K, L63P, C67S  
>01_LEV707| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEISGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005