<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patSAN 01_SANC718 France 2001 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 D4T+SQV 114
2 D4T+IDV 16
3 3TC+AZT+IDV+RTV 13
4 3TC+AZT+EFV 10
5 ABC+AZT+EFV 8

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73S, L89V L10V, I13V, G16A, K20R, E35D, M36I, N37E, R41K, D60E, I62V, L63P, H69K  
>01_SANC718| codons 1-99
PQITLWQRPVVTVKIAGQLREALLDTGADDTVLEDIELPGKWKPKIIGGIGGFIKVRQYE
QVPIEICGKKAISTVLVGPTPVNVIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y K219R G190E   E6D, K20R, V35I, T39N, E44D, V118I, K122E, D123N, I135V, K173M, Q174K, D177E, G196E, E203K, Q207S, H208Y, R211N, K223E, K238R, V245K, P247Q, E248K K11P, P157A, V179N, H235I
>01_SANC718| codons 1-249
PISPIDTVPVPLKPGMDGPRVKQWPLTEEKIKALIEICNELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSAAIFQSSMTKILEPFRMKNPEINI
YQYMDDLYVESDLEIEQHRTKIKELRSYLWNWGFYTPDRKHQEEPPFLWMGYELIPDRWT
VQPIKLQKK

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004