<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patSAN 01_SANC718 France 2001 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 D4T+SQV 114
2 D4T+IDV 16
3 3TC+AZT+IDV+RTV 13
4 3TC+AZT+EFV 10
5 ABC+AZT+EFV 8

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73S, L89V L10V, I13V, G16A, K20R, E35D, M36I, N37E, R41K, D60E, I62V, L63P, H69K  
>01_SANC718| codons 1-99
PQITLWQRPVVTVKIAGQLREALLDTGADDTVLEDIELPGKWKPKIIGGIGGFIKVRQYE
QVPIEICGKKAISTVLVGPTPVNVIGRNVMTQIGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004