<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patELA 02_ELA701 France 2002 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 30
2 DDC+ AZT 8
3 SQV+ RTV+ D4T+ 3TC 25
4 Unknown 152
5 AZT+ ABC+ 3TC 114

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, E35D, M36I, R41K, L63A, G68E, H69K, K70R, L89I, T91V, I93L  
>02_ELA701| codons 1-99
PQITLWQRPLVTVKIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIAIEICEKRAIGTVLVGPTPVNIIGRNILVQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K101E   V35T, D121H, K122E, D123E, I142V, K173S, Q174K, D177E, T200A, Q207A, R211K  
>02_ELA701| codons 1-238
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
HEEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDK

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004