<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patBES 02_BES706 France 2002 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 119
2 None 167
3 SQV+ D4T+ 3TC 104
4 AZT+ ABC+ 3TC 39
5 None 39
6 EFV+ DDI+ ABC+ 3TC 13
7 RTV+ AZT+ ABC+ 3TC 4
8 EFV+ DDI+ ABC+ 3TC 4
9 DDI+ D4T+ AZT 17
10 DDI+ AZT+ ABC 23

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R T215I, K219Q K103N A98G K11T, V35P, K46Q, V60I, T69N, K122E, D123S, I135T, K173S, Q174K, D177E, T200A, Q207A, R211S, F214L  
>02_BES706| codons 1-240
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALPEICTEMEKEGQISKIGPENPYNTPI
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGLITPDQKHQKEPPFLWMGYELHPDKWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, I15V, E35D, M36I, R41K, R57K, H69K, L89M G94A
>02_BES706| codons 1-99
PQITLWQRPLVTVRVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIACTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004