<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patBES 01_BES703 France 2001 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 119
2 None 167
3 SQV+ D4T+ 3TC 104
4 AZT+ ABC+ 3TC 39
5 None 39
6 EFV+ DDI+ ABC+ 3TC 13
7 RTV+ AZT+ ABC+ 3TC 4
8 EFV+ DDI+ ABC+ 3TC 4
9 DDI+ D4T+ AZT 3

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q K103N A98G V35T, T39A, K46Q, V60I, T69N, K122E, D123S, I135T, K173S, Q174K, D177E, T200A, Q207A, R211S, F214L  
>01_BES703| codons 26-238
LTEEKIKALTEICAEMEKEGQISKIGPENPYNTPIFAIKKKNSNRWRKLVDFRELNKRTQ
DFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPGIRYQ
YNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIVIYQYVDDLYVGSDLEIGQHRAKIEEL
RAHLLSWGLTTPDQKHQKEPPFLWMGYELHPDK

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004