<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patROUZ 99_ROUZ719 France 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 56
2 AZT+ 3TC 47
3 SQV+ D4T 13
4 IDV+ D4T+ 3TC 115

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46L, I47V, V82A   I62V, L63P, A71T, V77I, I93L  
>99_ROUZ719| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTILEEMNLPGRWKPKLVGGIGGFIKVRQYD
QVPIEICGHKTIGTVLIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       V35R, T39A, K43E, D123E, I135V, I142V, S162C, Q207E, R211K, L228H  
>99_ROUZ719| codons 1-237
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALREICAELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEPPFHWMGYELHPD

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005