<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patSAA 01_SAA704 France 2001 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 DDC+ AZT 52
2 DDC+ AZT+ 3TC 4
3 AZT+ 3TC 26
4 NVP+ DDI+ D4T 21
5 NVP+ DDI 21
6 DDI+ AZT+ 3TC 17
7 NFV+ D4T+ ABC 4
8 SQV+ D4T+ ABC 17
9 None 74
10 EFV+ AZT+ 3TC 51

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, I15V, E35D, M36I, R41K, H69K, L89M  
>01_SAA704| codons 1-99
PQITLWQRPIVTVKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V K219Q K103N K238T E6K, K11T, K20R, V35T, E36A, T39K, K122E, D123N, I142V, S162Y, K173S, D177E, V179I, I202V, Q207A, R211K, F214L, K223Q, L228H  
>01_SAA704| codons 1-239
PISPIKTVPVTLKPGMDGPRVKQWPLTEEKIKALTAICKEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQYSMTKILEPFRSQNPEIII
YQYVDDLYVGSDLEIGQHRTKVEELRAHLLKWGLTTPDQKHQQEPPFHWMGYELHPDTW

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004