<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patSAA 00_SAA713 France 2000 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 DDC+ AZT 52
2 DDC+ AZT+ 3TC 4
3 AZT+ 3TC 26
4 NVP+ DDI+ D4T 21
5 NVP+ DDI 21
6 DDI+ AZT+ 3TC 17
7 NFV+ D4T+ ABC 4
8 SQV+ D4T+ ABC 17
9 None 34

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, I15V, E35D, M36I, R41K, H69K, L89M  
>00_SAA713| codons 1-99
PQITLWQRPIVTVKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6K, K11T, K20R, V35T, E36A, T39K, K43E, K122E, D123N, S162Y, K173S, D177E, V179I, I202V, Q207A, R211K, F214L  
>00_SAA713| codons 1-244
PISPIKTVPVTLKPGMDGPRVKQWPLTEEKIKALTAICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRSQNPEIII
YQYMDDLYVGSDLEIGQHRTKVEELRAHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPI

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004