<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KDR_pat268 A0370 U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT 24

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V60VI, S68G, D121H, K122E, I135T, K166R, D177E, G196E  
>A0370| codons 38-244
CTEMEKEGKISKIGPENPYNTPIFAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLHEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPEIVIYQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15IV, I64IV, I72IV  
>A0370| codons 4-99
TLWQRPLVSIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQIL
VEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Kuritzkes, DR Rate of thymidine analogue resistance mutation accumulation with zidovudine- or stavudine-based regimens. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005