<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KDR_pat192 A0261 U.S. 1996 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T 28

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, K20R, E35D, M36I, R41K, R57K, L63T, E65D, H69HY, I72T, L89M  
>A0261| codons 4-99
TLWQRPLVTIKVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDQIT
IDICGYKATGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       T39A, K122KR, D123E, I135L, I142S, S162Y, K173R, D192N, Q207A, R211K  
>A0261| codons 38-244
CAEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDREFRKYTAFTIPSLNNETPGSRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRRQNPDIVIYQYVDDLYVGSNLEIGQHRTKIEELRAHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPI

References
Author Title Citation
Kuritzkes, DR Rate of thymidine analogue resistance mutation accumulation with zidovudine- or stavudine-based regimens. JAIDS, 2004