<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KDR_pat175 A0230 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT 90

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        S68G, V90I, D123E, R211RK  
>A0230| codons 38-244
CTEMEKEGKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFRELNKRTQDFWEIQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, N37ST, L63P, V77I  
>A0230| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMTLPGRWKPKMIGGIGGFIKVRQYDQIP
IEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Kuritzkes, DR Rate of thymidine analogue resistance mutation accumulation with zidovudine- or stavudine-based regimens. JAIDS, 2004
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012