<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KDR_pat143 A0179 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T 70

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, M184V T215C     A98S, E138A, I142IT, S162A, T200A S68SDGN
>A0179| codons 38-244
CTELEKEGKISKIGPENPYNTPVFAIKKKDNTKWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNATPGTRYQYNVLPQGWKGSP
AIFQASMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFCTP
DKKHQKEPPFLWMGYELHPDKWTVQPI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G17E, Q18I, L19I, M36I, R41K, I62IV, L63P  
>A0179| codons 4-99
TLWQRPLVTIKIGEIIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQVP
IEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Kuritzkes, DR Rate of thymidine analogue resistance mutation accumulation with zidovudine- or stavudine-based regimens. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005