<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KDR_pat77 A0089 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T 24
2 3TC+ D4T 48

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70KR       K103R, K122KE, T139TI, R211K, F214L, K223KR  
>A0089| codons 39-244
TEMEKEGKISKIGPENPYNTPVFAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPA
GLKKRKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNEIPGIRYQYNVLPQGWKGSPA
IFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGLTTPD
KKHQREPPFLWMGYELHPDKWTVQPI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12TI, E35D, R57RK, I62IV, L63P  
>A0089| codons 4-99
TLWQRPLVIIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVKQYDQVP
IEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Kuritzkes, DR Rate of thymidine analogue resistance mutation accumulation with zidovudine- or stavudine-based regimens. JAIDS, 2004
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005