<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KDR_pat62 A0074 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT 65

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V90I, K102Q, I142V, S162SN, K166KR, E169ED, R211K  
>A0074| codons 38-244
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHP
AGLKQKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQNSMTRILDPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12N, E35D, L63P  
>A0074| codons 4-99
TLWQRPLVNIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYDQIP
IEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Kuritzkes, DR Rate of thymidine analogue resistance mutation accumulation with zidovudine- or stavudine-based regimens. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005