<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
01THOUR598I 01_598I Thailand 2001 HIV1 CRF01_AE PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, E35D, M36I, R41K, W42*, H69K, L89M G51R
>01_598I| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEDINLPGK*KPKMIGGIRGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Tovanabutra, S The changing molecular epidemiology of HIV type 1 among northern Thai drug users, 1999 to 2002. ARHR, 2004