<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
00THOUR595I 00_595I Thailand 2000 HIV1 CRF01_AE PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, M36I, R41K, L63P, H69K, L89M, I93L  
>00_595I| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V35T, T39K, K43E, K122E, D123S, S162C, K173R, Q174K, D177E, T200I, Q207T, R211S, K238R, V245E, K249R, T286A, E291D, V292I, I293V, E312T, I326V, I329V, G335D, M357K, G359S, K366R, A371V, K390R, K395R, A400T, T403M, E432D, V435A, N447S, D471E, Q480H, L491S, K512R, L517V, S519N, Q524E, A534S, A554S  
>00_595I| codons 1-560
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRRKNPEIVI
YQYMDDLYVGSDLEIGQHRIKIEELRTHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPERDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKTPVHGVYYDPSKDLVAEVQKQGQDQWTYQIYQEPFKNLKTGKYARKRSA
HTNDVRQLTEVVQKIATESIVIWGKTPKFRLPIQRETWETWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIAGAETFYVDGAASRETKLGKAGYVTDRGRQKVVSLTETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDRSESEVVNQIIEELIKKEKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, E13D, K14R, A21T, S39N, I72V, Y99H, T112V, T124A, T125A, G134N, I135V, K136Q, D167E, V201I, L234I E152Q, S283G
>00_595I| codons 1-288
FLDGIDKAQEDHDRYHSNWRTMASDFNLPPVVAKEIVANCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAHFLLKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWANVQQEFGIPYNPQSQGVVQSMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Tovanabutra, S The changing molecular epidemiology of HIV type 1 among northern Thai drug users, 1999 to 2002. ARHR, 2004