<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KF_Pat11 KF00U1157 Cameroon 2001 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39S, E40D, K49R, V60I, S68G, K104R, K122E, D123G, S162A, K173I, Q174K, D177E, I178M, T200A, Q207E, R211K, V245Q, K281R, T286A, E291D, V292I, I293V, P294T, S322A, G335D, R356K, M357R, G359S, A371V, K374R, I375V, T377M, K390R, A400T, T403M, E432D, V435E, A437V, T470P, D471E, Q480H, L491S, K512R, L517I, S519N, Q524R, K527E, E529D, A534S  
>KF00U1157| codons 22-534
KQWPLTEEKIKALTEICSDMEKEGKISRIGPENPYNTPIFAIKKKDGTKWRKLVDFRELN
KRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPLDEGFRKYTAFTIPSINNETPG
IRYQYNVLPQGWKGSPAIFQASMTKILEPFRIKNPEMVIYQYMDDLYVGSDLEIGQHRAK
IEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIQLPEKDSWTVNDIQKLV
GKLNWASQIYAGIKVKQLCRLLRGAKALTDIVTLTEEAELELAENREILKEPVHGVYYDP
AKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKRRSAHTNDVKQLTEVVQRVAMESIV
IWGKTPKFRLPIQKETWETWWMEYWQATWIPEWEFVNTPPLVKLWYQLEKDPIEGVETFY
VDGAANRETKLGKAGYVTDRGRQKVVSLPETTNQKTELHAIHLALQDSGSEVNIVTDSQY
ALGIIQAQPDRSESEIVNQIIERLIEKDKVYLS

References
Author Title Citation
Konings, FAJ V118I substitution in the reverse transcriptase gene of HIV type 1 CRF02_AG strains infecting drug-naive individuals in Cameroon. ARHR, 2004