<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MI_Pat52 00SE18474 Sweden 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36I, N37D, H69K, T74A, L89M, I93L  
>00SE18474| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEIDLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGAVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, S48T, K122E, D123G, A158AS, S162SC, K173T, D177E, I178L, T200A, Q207E, P243T, V245Q, E248D, T286A, E291D, V292I, I293V, D324E, Q334H, G335D  
>00SE18474| codons 1-341
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQCSMTKILEPFRTQNPELVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQTIQLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGHDQWTYQI

References
Author Title Citation
Maljkovic, I Limited transmission of drug-resistant HIV type 1 in 100 Swedish newly detected and drug-naive patients infected with subtypes A, B, C, D, G, U, and CRF01_AE. ARHR, 2003