<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MI_Pat16 98SE14962 Sweden 1998 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, M36I, N37S, R41K, K43R, Q61H, H69K, L89M  
>98SE14962| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEISLPGKWRPKMIGGIGGFIKVRQYD
HILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11T, V35T, T39E, K122E, D123S, I135T, K173I, Q174K, D177E, Q207A, R211S, V245K, T286A, E291D, V292I, I293V, E312N, I326V, I329V, G335D  
>98SE14962| codons 1-341
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKNPVHGVYYDPSKDLVAEVQKQGQDQWTYQI

References
Author Title Citation
Maljkovic, I Limited transmission of drug-resistant HIV type 1 in 100 Swedish newly detected and drug-naive patients infected with subtypes A, B, C, D, G, U, and CRF01_AE. ARHR, 2003