Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| CA1617 | CA4591 | U.S. | 1998 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | 78 |
| 2 | AZT+3TC+IDV | 56 |
| 3 | D4T+3TC+NFV | 43 |
| 4 | 3TC+AZT+RTV+SQV | 26 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| V32I, M46I, I54V, V82A, L90M | K43T, F53L | L10I, K20R, E35D, M36I, N37E, I62V, L63H, A71LV, I72V |
| >CA4591| codons 1-99 PQITLWQRPIVTIKIGGQLREALLDTGADDTILEDIELPGRWTPKIIGGIGGLVKVRQYD QVHIEICGHKLVGTVLVGPTPANIIGRNLMTQIGCTLNF |
References
| Author | Title | Citation |
| Gonzales, MJ | HIV-1 reverse transcriptase and protease subtypes: classification, amino acid mutation patterns, and prevalence in a Northern California clinic-based population. | J Infect Dis, 2001 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |
| Rhee, SY | Predictive Value of HIV-1 Genotypic Resistance Test Interpretation Algorithms. | J Infect Dis, 2009 |