<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1617 CA4591 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 78
2 AZT+3TC+IDV 56
3 D4T+3TC+NFV 43
4 3TC+AZT+RTV+SQV 26

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I54V, V82A, L90M K43T, F53L L10I, K20R, E35D, M36I, N37E, I62V, L63H, A71LV, I72V  
>CA4591| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTILEDIELPGRWTPKIIGGIGGLVKVRQYD
QVHIEICGHKLVGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: classification, amino acid mutation patterns, and prevalence in a Northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Rhee, SY Predictive Value of HIV-1 Genotypic Resistance Test Interpretation Algorithms. J Infect Dis, 2009