<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1599 CA4553 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC+SQV 21
2 D4T+DDI+SQV 21
3 D4T+DDI+NFV 21
4 NVP+IDV 26
5 D4T+DDI+RTV 68

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S L10I, K20KR, E35D, M36I, N37ND, I62V, L63P, H69K, A71V, V77I  
>CA4553| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGKKVISTVLIGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, L210W, T215F K219E K103N, Y181C, G190A   K11Q, V35M, T39A, E40F, P55PS, T69N, R83RK, K122E, D123N, R172RK, V179VI, E194D, I195L, T200A, E203X, H208Y, R211RK, K223Q, L228H  
>CA4554| codons 1-269
PISPIETVPVQLKPGMDGPKVKQWPLTEEKIKALMEICAFLEKEGKISKIGPENSYNTPV
FAIKKKNSNRWRKIVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIII
CQYMDDLYVASDLDLGQHRAKIXELRQYLWKWGFFTPDEKHQQEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQ

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: classification, amino acid mutation patterns, and prevalence in a Northern California clinic-based population. J Infect Dis, 2001
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005