<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1290 CA4541 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 22
2 D4T 35
3 3TC+AZT+SQV 13
4 3TC+AZT+IDV 48
5 3TC+AZT+DDI+NFV+NVP 17
6 3TC+AZT+IDV 26
7 D4T+RTV+SQV 25

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48GV, V82AT, I84IV, L90M K43T, F53FL, G73T L10I, I15V, M36I, N37D, L63P, C67CF, H69K, A71AV, I93L  
>CA4541| codons 1-99
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEEIDLPGRWTPKIIVGIGGLIKVRQYD
QIPIEIFGKKVITTVLVGPTPANVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184MV, T215F K219Q K103N   K122E, I178M, T200A, Q207E, L210LM, D218E, D250A, A272P, E297A  
>CA4542| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLMRWGFFTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKASWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTAEAE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005