<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ESH_Pat115 ESH729 Uganda 1998 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None 52
2 NVP NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, E35D, M36I, R41K, R57K, H69K, L89M  
>ESH729| codons 1-99
PQITLWQRPLVTVRIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y181YC   V35T, K49R, V60I, D121X, K122E, D177E, I178M, E194ED, T200TI, Q207G, R211K, V245K, D250E, A272P, L282C, T286A, E297D, D324E  
>ESH729| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
XEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
CQYMDDLYVGSDLDIGQHRIKIEELRGHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKCLRGAKALTEVIPLTDEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGQ

References
Author Title Citation
Eshleman, SH Characterization of nevirapine resistance mutations in women with subtype A vs. D HIV-1 6-8 weeks after single-dose nevirapine. JAIDS, 2004