<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1589 CA4530 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 22
2 D4T 43
3 AZT+D4T+DDC 13
4 D4T 17
5 3TC+D4T+SQV 13
6 3TC+D4T+IDV 22
7 3TC+AZT+DDI 22
8 3TC+D4T+DDI+NFV+SQV 48
9 DDI+EFV+RTV+SQV 28

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, M184V, L210W, T215Y K219N L100I, K103N   V35L, T39A, V118I, K122E, G196E, T200A, E203K, H208Y, R211K, K223E, L228H  
>CA4530| codons 1-264
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICAELEKEGKISKIGPENPYNTPV
FAIKKKNSDKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRAKIKELRQYLWKWGFYTPDNKHQEEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M F53L, G73S L10I, E35D, D60E, Q61E, L63P, A71V, V77I, I93L  
>CA4529| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKIIGGIGGLIKVRQYE
EIPIEICGHKVISTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005