<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ESH_Pat47 ESH626 Uganda 1998 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None 52
2 NVP NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L24LF, M36I, R41K, R57K, L63P, C67Y  
>ESH626| codons 1-99
PQITLWQRPLVTVKIGGQLKEALFDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVKQYD
QIPIEIYGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35A, T39S, E40D, K49R, V60I, T69TI, R83K, L100X, D177E, I178M, T200I, Q207E, R211K, V245K, D250E, A272P, K277R, L282C, L283I, T286A, I293V N81NI
>ESH626| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALAEICSDMEKEGKISRIGPENPYNTPI
FAIKKKDSIKWRKLVDFRELIKKTQDFWEVQLGIPHPAGXKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYMDDLYVGSDLEIGQHRIKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKCIRGAKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQ

References
Author Title Citation
Eshleman, SH Characterization of nevirapine resistance mutations in women with subtype A vs. D HIV-1 6-8 weeks after single-dose nevirapine. JAIDS, 2004