<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ESH_Pat30 ESH839 Uganda 1998 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None 52
2 NVP NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, I15V, K20R, E35D, M36I, N37D, L63H, H69K, K70E, L89M  
>ESH839| codons 1-99
PQITLWQRPLVTVRVGGQLREALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFIKVRQYD
QIHIEICGKEAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103KN, Y181YC   E6D, K11Q, V35T, E40D, K49R, V60I, D123N, T165I, K173T, D177E, T200A, Q207E, V245Q, D250E, I293V, P294T  
>ESH839| codons 1-334
PISPIDTVPVQLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKNFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRTQNPEIVI
CQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQ

References
Author Title Citation
Eshleman, SH Characterization of nevirapine resistance mutations in women with subtype A vs. D HIV-1 6-8 weeks after single-dose nevirapine. JAIDS, 2004