<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ESH_Pat7 ESH754 Uganda 1998 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None 52
2 NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103KN   E6N, V35T, K43R, K122E, D123X, I142V, K173AE, D177E, I178IM, V179I, T200A, Q207A, R211S, V245E, E291ED, I293V, P294T  
>ESH754| codons 1-334
PISPINTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEREGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEXFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEMII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTDVVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, K45R, R57K, L63LP, H69K, L89M  
>ESH754| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVKQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Eshleman, SH Characterization of nevirapine resistance mutations in women with subtype A vs. D HIV-1 6-8 weeks after single-dose nevirapine. JAIDS, 2004