<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ESH_Pat6 ESH469 Uganda 1998 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None 52
2 NVP NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, E35D, M36I, R41K, D60E, L63P, H69K, L89M  
>ESH469| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYE
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35VI, I47IL, K49R, I50V, V60I, D121DN, I178M, T200A, Q207A, V245K, A272P, K277R, L282C, T286A, I293IV, E297K, S322L  
>ESH469| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKLSRVGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
NKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKCLRGAKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPLKDLIAEIQKQGQ

References
Author Title Citation
Eshleman, SH Characterization of nevirapine resistance mutations in women with subtype A vs. D HIV-1 6-8 weeks after single-dose nevirapine. JAIDS, 2004