<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1581 CA4512 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 30
2 SQV 21
3 3TC+ SQV 8
4 3TC+ D4T+ SQV 12
5 3TC+ DDI+ D4T+ SQV 13
6 3TC+ DDI+ IDV+ D4T+ SQV 28
7 3TC+ DDI+ SQV+ NVP+ IDV 12
8 3TC+ NFV+ SQV 34
9 DDI+ SQV+ RTV 11
10 DDI+ ABC+ EFV+ SQV+ RTV 14

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, V75M, M184V, T215Y   K103N V108I K64R, K122E, G196E, H221HY, D237N, A272P, K277R, T286A, E297K N265NT
>CA4512| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIRKKDSTKWRKIMDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGFYTPDKKYQKEPPFLWMGYELHPNKWT
VQPIVLPEKDSWTVNDIQKLVGKLTWASQIYPGIKVRQLCKLLRGAKALTEVIPLTKEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V L24I, T74P L10I, K43R, D60E, I62V, L63Q, I64V, H69R, A71V, V77I, I93L  
>CA4511| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVLEEMNLPGRWRPKIIGGIGGFIKVRQYE
QVQVEICGRKVIGPVLIGPTPVNVIGRNLLTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005