<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1579 CA4505 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 134
2 3TC+AZT 63
3 D4T+DDI+IDV 16
4 3TC+AZT+IDV 16
5 D4T+DLV+RTV+SQV 47

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A, I84V F53L N37D, L63P, A71AT, V77I, I93L  
>CA4505| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIVGIGGLVKVRQYD
QIPIEICGHKTIGTVLIGPTPANVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y       K20R, K122E, E138G, D177E, I178L, R211K, K220X P140PQ
>CA4506| codons 1-220
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNGTQGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPELVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKX

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009