<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
VHE_Pat66 VHE133prrt Saint Lucia 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19T, M36I, R41K, D60E, L63P, H69K, L89I, I93L  
>VHE133prrt| codons 1-99
PQITLWQRPLVSIKVGGQTKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYE
QIPIEICGKKAIGTVLVGPTPVNIIGRNILTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39E, S48T, K122E, D123S, I135R, S162C, K173T, Q174K, T200A, Q207E, R211K  
>VHE133prrt| codons 1-237
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRTKNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPD

References
Author Title Citation
Vaughan, HE Characterization of HIV type 1 clades in the Caribbean using pol gene sequences. ARHR, 2003