<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
VHE_Pat31 VHE031prrt Trinidad 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19Q, E35D, M36L, D60E, Q61E, L63P, A71T  
>VHE031prrt| codons 1-99
PQITLWQRPLVTIKVGGQQKEALLDTGADDTVLEDLNLPGRWKPKMIGGIGGFIKVRQYE
EIPIEICGHKTIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39L, K122Q, S162C, K173Q, Q174K, D177E, T200A, Q207A, R211K, F214L  
>VHE031prrt| codons 1-230
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICLEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DQDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRQKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLKWGLTTPDKKHQKEPPFLWM

References
Author Title Citation
Vaughan, HE Characterization of HIV type 1 clades in the Caribbean using pol gene sequences. ARHR, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005