<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RNJCR21 RNJCR21 Uganda 2000 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 DDI 21
2 3TC+ DDI 47
3 AZT+ DDC 35
4 D4T+ DDI 39
5 3TC+ AZT+ NFV 21

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  D67S     K11T, K20R, V35T, K43E, K49R, V60I, T69P, W71*, K122E, D123S, K173S, D177E, V179I, E194D, T200A  
>RNJCR21| codons 1-206
PISPIETVPVTLKPGMDGPRVKQWPLTEEKIKALTEICTEMEEEGKISRIGPENPYNTPI
FAIKKKSSPK*RKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSQNPEIII
YQYMDDLYVGSDLDIGQHRAKIEELR

References
Author Title Citation
Richard, N High prevalence of antiretroviral resistance in treated Ugandans infected with non-subtype B human immunodeficiency virus type 1. ARHR, 2004