<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RNJCR01 RNJCR01 Uganda 1999 HIV1 D PBMC None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 26

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L       P4T, V35T, K49R, V60I, K104N, K122E, I135T, I142T, E169D, I178L, T200A, I202V  
>RNJCR01| codons 1-206
PISTIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKNSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGTRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRAKVEELR

References
Author Title Citation
Richard, N High prevalence of antiretroviral resistance in treated Ugandans infected with non-subtype B human immunodeficiency virus type 1. ARHR, 2004