<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RNJCR58 RNJCR58 Uganda 2000 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ IDV 87
2 3TC+ ABC+ EFV 4

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   Y188H   K11T, V21I, V35T, V106I, K122E, D123S, I135L, I142V, K173S, Q174K, D177E, I178L, V179I, T200A  
>RNJCR58| codons 1-206
PISPIETVPVTLKPGMDGPKIKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
DESFRKYTAFTIPSLNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPELII
YQYVDDLHVGSDLEIGQHRAKIEELR

References
Author Title Citation
Richard, N High prevalence of antiretroviral resistance in treated Ugandans infected with non-subtype B human immunodeficiency virus type 1. ARHR, 2004