<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RNJCR55 RNJCR55 Uganda 2000 HIV1 D PBMC None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC 52
2 D4T+ DDI 26
3 3TC+ ABC+ EFV 34

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, M184V   K103N   E6D, K11H, K20R, V35T, T39D, V60I, D177E, I178M, T200A  
>RNJCR55| codons 1-206
PISPIDTVPVHLKPGMDGPRVKQWPLTEEKIKALTEICDEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYVDDLYVGSDLEIGQHRAKIEELR

References
Author Title Citation
Richard, N High prevalence of antiretroviral resistance in treated Ugandans infected with non-subtype B human immunodeficiency virus type 1. ARHR, 2004