<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RNJCR36 RNJCR36 Uganda 2000 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 DDI+ D4T 39
2 3TC+ AZT+ NVP 34

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V   K101E, G190A   V35T, V60I, D121H, K122E, D123S, I135T, K166R, K173S, Q174R, D177E, I178L, V179I, T200A  
>RNJCR36| codons 1-205
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRSRNPELII
YQYVDDLYVASDLEIGQHRAKIEEL

References
Author Title Citation
Richard, N High prevalence of antiretroviral resistance in treated Ugandans infected with non-subtype B human immunodeficiency virus type 1. ARHR, 2004