<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RNJCR17 RNJCR17 Uganda 2000 HIV1 D PBMC None

Treatment History
Order Regimen Weeks
1 3TC+ AZT 86
2 NFV+ NVP+ D4T 13
3 NFV+ NVP+ D4T 13

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    G190A   E28K, K32E, A33P, V35T, V60I, E79D, D121Y, K122E, I178M, T200I  
>RNJCR17| codons 1-206
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIEPLTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRDLNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVASDLEIGQHRIKIEELR

References
Author Title Citation
Richard, N High prevalence of antiretroviral resistance in treated Ugandans infected with non-subtype B human immunodeficiency virus type 1. ARHR, 2004