<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RN_Pat15 RNJLT15C Uganda 1999 HIV1 D PBMC None

Treatment History
Order Regimen Weeks
1 ABC+ 3TC+ D4T 17

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74I       K32I, V60I, K101Q, K122E, D177E, I178L S68C, K73T, N81H, K82M, E89A
>RNJLT15C| codons 1-206
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIIALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDCTKWRTIVDFRELHMRTQDFWAVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPELVI
YQYMDDLYVGSDLEIGQHRTKIEELR

References
Author Title Citation
Richard, N High prevalence of antiretroviral resistance in treated Ugandans infected with non-subtype B human immunodeficiency virus type 1. ARHR, 2004