<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RN_Pat9 RNJLT08D Uganda 1999 HIV1 D PBMC None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ EFV 26

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V   K103N   V35T, T39K, K43E, K49R, V60I, D121Y, K122E, I135T, I178M, T200A L92V, G93R
>RNJLT08D| codons 1-206
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISRIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQVRIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGQHRAKIEELR

References
Author Title Citation
Richard, N High prevalence of antiretroviral resistance in treated Ugandans infected with non-subtype B human immunodeficiency virus type 1. ARHR, 2004