<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SJ_Pat35 SJKLM043 Rwanda 2000 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19V, E35D, M36I, R41K, R57K, L63P, C67Y, H69K, L89M  
>SJKLM043| codons 4-99
TLWQRPLVTIKIGGQVKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDQIP
IEIYGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T39I, V60I, K122E, D123G, I135T, K173A, Q174K, D177E, V179I, T200I, Q207A, R211S, V245K  
>SJKLM043| codons 38-247
CIEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEGFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRAKNPEIIIYQYMDDLYVGSDLEIGQHRIKIEELRAHLLSWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Servais, J HIV type 1 pol gene diversity and archived nevirapine resistance mutation in pregnant women in Rwanda. ARHR, 2004