<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SJ_Pat33 SJKLM042 Rwanda 2000 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F I13V, K14R, I15V, G16E, K20I, E35D, M36I, R41K, R57K, H69K, L89M  
>SJKLM042| codons 4-99
TLWQRPLVTVRVEGQLIEALLDTGADDTVFEDINLPGKWKPKMIGGIGGFIKVKQYDQIL
IEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I37X, E42K, K122E, D123S, I135T, S162A, K173A, Q174R, D177E, I178M, V179I, Q207A, R211S R83S, T84TS
>SJKLM042| codons 37-232
XCTEMKKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKSSQDFWEVQLGIPH
PAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGS
PAIFQASMTKILEPFRARNPEMIIYQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTT
PDKKHQKEPPFLWMGY

References
Author Title Citation
Servais, J HIV type 1 pol gene diversity and archived nevirapine resistance mutation in pregnant women in Rwanda. ARHR, 2004