<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SJ_Pat32 SJKLM026 Rwanda 2000 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, I15IV, E35D, M36I, R41K, R57K, H69K, L89M  
>SJKLM026| codons 4-99
TLWQRPVVTVKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDQIL
IEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I37X, E40D, K49R, K122E, D123N, K173S, Q207A, R211S  
>SJKLM026| codons 37-244
XCTDMEKEGKISRIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPH
PAGLKKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGS
PAIFQSSMTKILEPFRSQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTT
PDKKHQKEPPFLWMGYELHPDKWTVQPI

References
Author Title Citation
Servais, J HIV type 1 pol gene diversity and archived nevirapine resistance mutation in pregnant women in Rwanda. ARHR, 2004